(data stored in ACNUC1104 zone)

EMBL: CP001966.PE423

CP001966.PE423       Location/Qualifiers
FT   CDS             complement(459505..460275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0436"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="KEGG: rop:ROP_15710 putative endonuclease IV; PFAM:
FT                   Xylose isomerase domain protein TIM barrel; SMART: AP
FT                   endonuclease family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77077"
FT                   /db_xref="GOA:D5URM4"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM4"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADG77077.1"
FT                   /translation="MRIGAHVRSDTHPVETAESLGVDVIQMFVADPQSWKKPEPHPQTQ
FT                   ALRDSPLEIVVHSAYVINVASLNNRLRMPSRKAVEQQAAAAADLGAFGLVVHGGHLRDG
FT                   EDLQGGIDNWRKLFTRQEEKGGFGVPILIENTAGGDGAIARQLETIDRLWDAVGDQGAG
FT                   FCLDTCHAWAGGEELLGIVERVLAITGRIDLVHLNNSRDEFDSARDRHANLQDGTIDPD
FT                   LLADVARAADAPVILETPADGLADDVAYLKEALL"
     MRIGAHVRSD THPVETAESL GVDVIQMFVA DPQSWKKPEP HPQTQALRDS PLEIVVHSAY        60
     VINVASLNNR LRMPSRKAVE QQAAAAADLG AFGLVVHGGH LRDGEDLQGG IDNWRKLFTR       120
     QEEKGGFGVP ILIENTAGGD GAIARQLETI DRLWDAVGDQ GAGFCLDTCH AWAGGEELLG       180
     IVERVLAITG RIDLVHLNNS RDEFDSARDR HANLQDGTID PDLLADVARA ADAPVILETP       240
     ADGLADDVAY LKEALL                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page