(data stored in ACNUC1104 zone)

EMBL: CP001966.PE424

CP001966.PE424       Location/Qualifiers
FT   CDS             460418..461599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0437"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="PFAM: protein of unknown function DUF1023; KEGG:
FT                   mjl:Mjls_0770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77078"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM5"
FT                   /inference="protein motif:PFAM:PF06259"
FT                   /protein_id="ADG77078.1"
FT                   /translation="MVVGEALRAPQSWTGGTAEAYDRWAGYAVRATAELDAALRRAEAE
FT                   IARGGPGLAERLAAIELPAAVPVREAPASAPEPAAWTRHRANRVRLAAQLRELRAIARP
FT                   TAAQRRRLAMAETVAARLAELDGAVDPITGARVPVQLLTYEPEAFGGDGAVVVSIGDLA
FT                   AADRVGVLVPGMGTTAASLGAVGGGAARLYAAARRADPDGSVAAIAWIGYDAPSGRGAA
FT                   AQVVTGHAASRGAERLRADLAEVSAMAPDDARTVVFGHSYGATTAATAGRHGALAGTVD
FT                   AMVLFGAPGAGPVRSAAELGLADGVYVARDRDDPVPPGAFLGGLAGRALGMVPGLMGLG
FT                   LGVDPAAESFGATAIAADGPTGRLGAHSGYLDAASPALAEFGRILAGVRDDAR"
     MVVGEALRAP QSWTGGTAEA YDRWAGYAVR ATAELDAALR RAEAEIARGG PGLAERLAAI        60
     ELPAAVPVRE APASAPEPAA WTRHRANRVR LAAQLRELRA IARPTAAQRR RLAMAETVAA       120
     RLAELDGAVD PITGARVPVQ LLTYEPEAFG GDGAVVVSIG DLAAADRVGV LVPGMGTTAA       180
     SLGAVGGGAA RLYAAARRAD PDGSVAAIAW IGYDAPSGRG AAAQVVTGHA ASRGAERLRA       240
     DLAEVSAMAP DDARTVVFGH SYGATTAATA GRHGALAGTV DAMVLFGAPG AGPVRSAAEL       300
     GLADGVYVAR DRDDPVPPGA FLGGLAGRAL GMVPGLMGLG LGVDPAAESF GATAIAADGP       360
     TGRLGAHSGY LDAASPALAE FGRILAGVRD DAR                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page