(data stored in ACNUC1104 zone)

EMBL: CP001966.PE426

CP001966.PE426       Location/Qualifiers
FT   CDS             463433..463975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0439"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: aau:AAur_0986
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77080"
FT                   /db_xref="GOA:D5URM7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041479"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77080.1"
FT                   /translation="MPPPPAARAKLLDAYVRILIEQGERAATLEAVAAEAGVSKGGLLY
FT                   HFGSKDALVEGLIGRLNELVEQDVELMRAAPEGAVDYYVRTSNYADTPLDRTIVAVLRL
FT                   SQVANTRAQEAIQAMQQRWLETLVEQVPDEAAARAVILMGDGLYYNAALSGGRHVATDE
FT                   QIEELLALVRHMLDAPR"
     MPPPPAARAK LLDAYVRILI EQGERAATLE AVAAEAGVSK GGLLYHFGSK DALVEGLIGR        60
     LNELVEQDVE LMRAAPEGAV DYYVRTSNYA DTPLDRTIVA VLRLSQVANT RAQEAIQAMQ       120
     QRWLETLVEQ VPDEAAARAV ILMGDGLYYN AALSGGRHVA TDEQIEELLA LVRHMLDAPR       180
//

If you have problems or comments...

PBIL Back to PBIL home page