(data stored in ACNUC1104 zone)

EMBL: CP001966.PE435

CP001966.PE435       Location/Qualifiers
FT   CDS             472842..473333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_3139c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77089"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D5US22"
FT                   /inference="similar to AA sequence:KEGG:MAB_3139c"
FT                   /protein_id="ADG77089.1"
FT                   /translation="MPALKPVLPADLTPGNPGVYEFSVRSARPVEWVWGELTSDTPLHW
FT                   CNGIRKIEWTSPRPFAAGSTRTVTLGPGISADEIFYSWEESEQLCEKAFYVQSATAPGL
FT                   SRLAEKYRVEALPEGGSLFTWTLLIEPVGGAKVIGLSGLPVGLIVKWLQRDTEKYLGSA
FT                   "
     MPALKPVLPA DLTPGNPGVY EFSVRSARPV EWVWGELTSD TPLHWCNGIR KIEWTSPRPF        60
     AAGSTRTVTL GPGISADEIF YSWEESEQLC EKAFYVQSAT APGLSRLAEK YRVEALPEGG       120
     SLFTWTLLIE PVGGAKVIGL SGLPVGLIVK WLQRDTEKYL GSA                         163
//

If you have problems or comments...

PBIL Back to PBIL home page