(data stored in ACNUC1104 zone)

EMBL: CP001966.PE436

CP001966.PE436       Location/Qualifiers
FT   CDS             473554..475011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0449"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: sgr:SGR_1958 putative catalase; PFAM: Catalase
FT                   related subgroup; Catalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77090"
FT                   /db_xref="GOA:D5US23"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:D5US23"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADG77090.1"
FT                   /translation="MTDHRNYTTTDSGAPAGSDQHSLTVGAGGPIVLHDHYLIEQMAQF
FT                   NRERIPERQPHAKGSGAFGTFETTADVSDYTCAALFQPGVTTDMVARFSTVAGERGSAD
FT                   TWRDPRGFALKFYTDEGVYDLVGNNTPVFFIKDPLKFQHFIRSQKRRADNNLRDHDMQW
FT                   DFWTLSPESSHQVTWLMGDRGIPKSWRHMNGYGSHTYLWVNDAGVKHWVKYHFISDQGI
FT                   DYLTQDEADRLAGADGDYHVRDLFEAIRDGEHPSWTLKVQIMPFEDAATYRYNPFDLTK
FT                   VWPHSDYPLVEVGTMTLHTNPTDNHAQIEQAAFEPNNLVPGIGLSPDRMLLGRVFAYAD
FT                   AHRARLGANYKQIPVNAPRNEVRSYSKDGAMRIDPVRDPVYAPNSKGGPSADYPGQAEP
FT                   QWAADGEIVRTAYVDHAEDDDVSQPRTLIREVMDEAARERLVDNVAGHLLDGVSPPVLQ
FT                   RAFEYWTNIDPEIGGRIERAVAEAGTD"
     MTDHRNYTTT DSGAPAGSDQ HSLTVGAGGP IVLHDHYLIE QMAQFNRERI PERQPHAKGS        60
     GAFGTFETTA DVSDYTCAAL FQPGVTTDMV ARFSTVAGER GSADTWRDPR GFALKFYTDE       120
     GVYDLVGNNT PVFFIKDPLK FQHFIRSQKR RADNNLRDHD MQWDFWTLSP ESSHQVTWLM       180
     GDRGIPKSWR HMNGYGSHTY LWVNDAGVKH WVKYHFISDQ GIDYLTQDEA DRLAGADGDY       240
     HVRDLFEAIR DGEHPSWTLK VQIMPFEDAA TYRYNPFDLT KVWPHSDYPL VEVGTMTLHT       300
     NPTDNHAQIE QAAFEPNNLV PGIGLSPDRM LLGRVFAYAD AHRARLGANY KQIPVNAPRN       360
     EVRSYSKDGA MRIDPVRDPV YAPNSKGGPS ADYPGQAEPQ WAADGEIVRT AYVDHAEDDD       420
     VSQPRTLIRE VMDEAARERL VDNVAGHLLD GVSPPVLQRA FEYWTNIDPE IGGRIERAVA       480
     EAGTD                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page