(data stored in ACNUC1104 zone)

EMBL: CP001966.PE437

CP001966.PE437       Location/Qualifiers
FT   CDS             complement(475018..475791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0450"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="TIGRFAM: methylthioadenosine phosphorylase; KEGG:
FT                   msm:MSMEG_0990 5'-methylthioadenosine phosphorylase; PFAM:
FT                   purine or other phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77091"
FT                   /db_xref="GOA:D5US24"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D5US24"
FT                   /inference="protein motif:TFAM:TIGR01694"
FT                   /protein_id="ADG77091.1"
FT                   /translation="MSAPIAVIGGTGLYRFLGGETTTRTVDTPYGPTSAPITLGEAGGR
FT                   EVAFLPRHGAHHEYSPHTVPYRANLWALHSLGVRKVLAPCAVGSLDPALGPGTIVVPDQ
FT                   VVDRTTSRASSYFDGGGVHVSFADPYCPELRAAARPHADHDGATMVVIEGPRFSTRAES
FT                   RWYAAQGWELVNMTGLPEAALARELKLCYASLALVTDLDAGIEAGDGVHAEDVLEQFKV
FT                   NLPRLTTALTHTLTAIEPDAECSCAAGDHDLSPLR"
     MSAPIAVIGG TGLYRFLGGE TTTRTVDTPY GPTSAPITLG EAGGREVAFL PRHGAHHEYS        60
     PHTVPYRANL WALHSLGVRK VLAPCAVGSL DPALGPGTIV VPDQVVDRTT SRASSYFDGG       120
     GVHVSFADPY CPELRAAARP HADHDGATMV VIEGPRFSTR AESRWYAAQG WELVNMTGLP       180
     EAALARELKL CYASLALVTD LDAGIEAGDG VHAEDVLEQF KVNLPRLTTA LTHTLTAIEP       240
     DAECSCAAGD HDLSPLR                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page