(data stored in ACNUC1104 zone)

EMBL: CP001966.PE44

CP001966.PE44        Location/Qualifiers
FT   CDS             complement(47409..48338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0044"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: rer:RER_48540 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76698"
FT                   /db_xref="GOA:D5UPT0"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT0"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ADG76698.1"
FT                   /translation="MSRALVIGCGGTIGGAWTMAALAALADQLDWDPREAAVLQGTSAG
FT                   AEIVTLLSGGYSPHELVSMQEERSADPVLTRHLAATPGSLPRIPISLPSQPSTLWSRTG
FT                   GHAPLTGVAPRGRGDARWLQELADSVLGVSAPVPERARLVAYEPATGERVAFGAAGAPS
FT                   ATAGEALRASWAIPAWMPPVTISGRTFVDGGAASTASLDLIAPDDADEIYAIVSMASAP
FT                   GVRGPGIGGLMEQALLRRPMSSVFWREVAVARARGQKVTVIAPDAADLAGLGANFMARG
FT                   KRAAAFAAAQRTAPQTVRRALSGEAVPR"
     MSRALVIGCG GTIGGAWTMA ALAALADQLD WDPREAAVLQ GTSAGAEIVT LLSGGYSPHE        60
     LVSMQEERSA DPVLTRHLAA TPGSLPRIPI SLPSQPSTLW SRTGGHAPLT GVAPRGRGDA       120
     RWLQELADSV LGVSAPVPER ARLVAYEPAT GERVAFGAAG APSATAGEAL RASWAIPAWM       180
     PPVTISGRTF VDGGAASTAS LDLIAPDDAD EIYAIVSMAS APGVRGPGIG GLMEQALLRR       240
     PMSSVFWREV AVARARGQKV TVIAPDAADL AGLGANFMAR GKRAAAFAAA QRTAPQTVRR       300
     ALSGEAVPR                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page