(data stored in ACNUC1104 zone)

EMBL: CP001966.PE440

CP001966.PE440       Location/Qualifiers
FT   CDS             476594..477640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0392c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77094"
FT                   /db_xref="GOA:D5US27"
FT                   /db_xref="UniProtKB/TrEMBL:D5US27"
FT                   /inference="similar to AA sequence:KEGG:MAB_0392c"
FT                   /protein_id="ADG77094.1"
FT                   /translation="MTGDEAEALRRRIDEQAVPLELIPIAPLGFRDLVVGAARALRTNP
FT                   RIMFGLTAVVVGVMGLVALIAQLSLVPGARATGVARADEDARQVLAALGVGSGVQVANS
FT                   ALSMVGTLLVTGMVTVVVARSVLRHRTRTAMAWSVAGRRLPALALLGVIEIGMILAPLT
FT                   AAVAAAILVAIAVGPSGVAGYVMLIGLLTVVAVFAMWPLFAMAAPAVVLERCGPVAALS
FT                   RAVDLIRPGYLRLLWRLLLVSATSYAVGLLIWIPFILLGRALSHADRGLVPSLFLVVGA
FT                   AIGQTVTLPFLAAMNTLLYTDQRIRLEEVAAELQRVADEAPSPDVAMVWQVTRPGADVA
FT                   PGTRSESQ"
     MTGDEAEALR RRIDEQAVPL ELIPIAPLGF RDLVVGAARA LRTNPRIMFG LTAVVVGVMG        60
     LVALIAQLSL VPGARATGVA RADEDARQVL AALGVGSGVQ VANSALSMVG TLLVTGMVTV       120
     VVARSVLRHR TRTAMAWSVA GRRLPALALL GVIEIGMILA PLTAAVAAAI LVAIAVGPSG       180
     VAGYVMLIGL LTVVAVFAMW PLFAMAAPAV VLERCGPVAA LSRAVDLIRP GYLRLLWRLL       240
     LVSATSYAVG LLIWIPFILL GRALSHADRG LVPSLFLVVG AAIGQTVTLP FLAAMNTLLY       300
     TDQRIRLEEV AAELQRVADE APSPDVAMVW QVTRPGADVA PGTRSESQ                    348
//

If you have problems or comments...

PBIL Back to PBIL home page