(data stored in ACNUC1104 zone)

EMBL: CP001966.PE443

CP001966.PE443       Location/Qualifiers
FT   CDS             480700..481929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0456"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcj:BCAM1381 major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77097"
FT                   /db_xref="GOA:D5US30"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5US30"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG77097.1"
FT                   /translation="MVSIGIVDTKAAAETPRRWTTVMLLVAVTAPQLGLSLLNPSIPQM
FT                   AVDLHTTVSAVQLTLSGYMAGYAVSMFAAGILADRFDARTVQALGLLLFAVGGVAAAAA
FT                   PSVAVLGAARFVQAIGGTSATVLCRLVIQRRYPADTRMQLLTSLSIVIAATPAISPFLG
FT                   SALVQVLAWRALFLGLAVVGVMLAVAFLLLVPAAPPEVPVSPTPRMVGRGIAEAVRERG
FT                   FRRHALVISLAWMGYFLFIEQSSFVLQELHGATELQYGLLLVVPAIGYIAGSVLVRRAP
FT                   AVVRAVRFGAVASLLGAAALVILAAVGVHNPAAVVVPLAVGFVGVGAAIPFSQAGLLEL
FT                   DLAAQGVGAGLFFFLQMASGAVYSVIVEGLRLRGSLSVSLAIALPLFCLAVTVAITTRA
FT                   RNRQGENANA"
     MVSIGIVDTK AAAETPRRWT TVMLLVAVTA PQLGLSLLNP SIPQMAVDLH TTVSAVQLTL        60
     SGYMAGYAVS MFAAGILADR FDARTVQALG LLLFAVGGVA AAAAPSVAVL GAARFVQAIG       120
     GTSATVLCRL VIQRRYPADT RMQLLTSLSI VIAATPAISP FLGSALVQVL AWRALFLGLA       180
     VVGVMLAVAF LLLVPAAPPE VPVSPTPRMV GRGIAEAVRE RGFRRHALVI SLAWMGYFLF       240
     IEQSSFVLQE LHGATELQYG LLLVVPAIGY IAGSVLVRRA PAVVRAVRFG AVASLLGAAA       300
     LVILAAVGVH NPAAVVVPLA VGFVGVGAAI PFSQAGLLEL DLAAQGVGAG LFFFLQMASG       360
     AVYSVIVEGL RLRGSLSVSL AIALPLFCLA VTVAITTRAR NRQGENANA                   409
//

If you have problems or comments...

PBIL Back to PBIL home page