(data stored in ACNUC1104 zone)

EMBL: CP001966.PE445

CP001966.PE445       Location/Qualifiers
FT   CDS             complement(482836..484209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0458"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   nfa:nfa12290 putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77099"
FT                   /db_xref="GOA:D5US32"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D5US32"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADG77099.1"
FT                   /translation="MTDAPLRRGLTARHIRFIALGSAIGTGLFYGSAKAIQAAGPSVLL
FT                   AYVIGGLVIYLVLRALGEMAVRNPQGSFGDYASSSLGPRAGFMTGWMYVFEMVFVCIAD
FT                   VTAFGTYMGLWFPHVPKWIWVLAVILFIGALNMMRVKVFGEVEFWLTMVKITAIVAMIF
FT                   GGIAVLIFGFGMHDTSRGVSNLWGDGGFFATGFLGFLSCFVLVVFAFGGSEIIGLTAAE
FT                   AEDPERTIPKAINTVPVRIGLFYVLALAVIMAVIPWNQISSESSPFVQIFQALGVEPAA
FT                   HVLNVVVITAAISAINSDIYGAGRMMFGMAQRGQAPTIMQKVSRNGVPWMTVVIMAAAL
FT                   LVGVVLNAAIPENVFVVIASIATFATVFVWLMILFSQYRQRTAMSADEQSALTFPVPLW
FT                   PYGQLIAIAFLLFVTVLMAFQPDTRVALIVGFVWLAFLAAAYAVWVAPKAAVRSGSER"
     MTDAPLRRGL TARHIRFIAL GSAIGTGLFY GSAKAIQAAG PSVLLAYVIG GLVIYLVLRA        60
     LGEMAVRNPQ GSFGDYASSS LGPRAGFMTG WMYVFEMVFV CIADVTAFGT YMGLWFPHVP       120
     KWIWVLAVIL FIGALNMMRV KVFGEVEFWL TMVKITAIVA MIFGGIAVLI FGFGMHDTSR       180
     GVSNLWGDGG FFATGFLGFL SCFVLVVFAF GGSEIIGLTA AEAEDPERTI PKAINTVPVR       240
     IGLFYVLALA VIMAVIPWNQ ISSESSPFVQ IFQALGVEPA AHVLNVVVIT AAISAINSDI       300
     YGAGRMMFGM AQRGQAPTIM QKVSRNGVPW MTVVIMAAAL LVGVVLNAAI PENVFVVIAS       360
     IATFATVFVW LMILFSQYRQ RTAMSADEQS ALTFPVPLWP YGQLIAIAFL LFVTVLMAFQ       420
     PDTRVALIVG FVWLAFLAAA YAVWVAPKAA VRSGSER                                457
//

If you have problems or comments...

PBIL Back to PBIL home page