(data stored in ACNUC1104 zone)

EMBL: CP001966.PE446

CP001966.PE446       Location/Qualifiers
FT   CDS             484292..484861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0459"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="KEGG: rop:ROP_54420 deoxycytidine triphosphate
FT                   deaminase; TIGRFAM: deoxycytidine triphosphate deaminase;
FT                   PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77100"
FT                   /db_xref="GOA:D5US33"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D5US33"
FT                   /inference="protein motif:TFAM:TIGR02274"
FT                   /protein_id="ADG77100.1"
FT                   /translation="MLLSDRDIRAQLDSGRLGIEPFDTQLVQPSSVDVRLDGLFRVFNN
FT                   TRYTHIDPAQRQDELTSLVEPDPGEPFVLHPGEFVLGSTLEVCSLPDDLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCLFRLSSPADNPYG
FT                   SASTGSKYQGQRGPTPSKAYLNFQQD"
     MLLSDRDIRA QLDSGRLGIE PFDTQLVQPS SVDVRLDGLF RVFNNTRYTH IDPAQRQDEL        60
     TSLVEPDPGE PFVLHPGEFV LGSTLEVCSL PDDLAGRLEG KSSLGRLGLL THSTAGFIDP       120
     GFSGHITLEL SNVANLPITL WPGMKIGQLC LFRLSSPADN PYGSASTGSK YQGQRGPTPS       180
     KAYLNFQQD                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page