(data stored in ACNUC1104 zone)

EMBL: CP001966.PE449

CP001966.PE449       Location/Qualifiers
FT   CDS             complement(487870..488877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_0458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77103"
FT                   /db_xref="GOA:D5US36"
FT                   /db_xref="UniProtKB/TrEMBL:D5US36"
FT                   /inference="similar to AA sequence:KEGG:Mjls_0458"
FT                   /protein_id="ADG77103.1"
FT                   /translation="MSKNHATLAAVFAGLAIAIPLIVLLFTAPAAKGAPHDLPIGVVGP
FT                   EAAVTQVSDRLDEQQPGGFDVKAYASADELIAAAENREVYGGIVLGAQPRAITATGASP
FT                   VVAPLITQLANAAAQGRTVQVTDVAPPSVDDPRGAGFGSMVMPVFLSGMVLALSTVMIG
FT                   GHPKIVAAALPIGAAVVGAAAVGAAMWIGVLPGGFGAQWLAMSAGMLAIGATVAGLVQL
FT                   LGTKGIAPAALLFMLVGMPLAGIAAPPEFLPHVWGVLGQSLPIGATGTALRGAAFFAPD
FT                   ALIGAGAGAAFAVLGAWIVVGYGLLTIGVARHRAQPSGAPSGERTPDAAVATPA"
     MSKNHATLAA VFAGLAIAIP LIVLLFTAPA AKGAPHDLPI GVVGPEAAVT QVSDRLDEQQ        60
     PGGFDVKAYA SADELIAAAE NREVYGGIVL GAQPRAITAT GASPVVAPLI TQLANAAAQG       120
     RTVQVTDVAP PSVDDPRGAG FGSMVMPVFL SGMVLALSTV MIGGHPKIVA AALPIGAAVV       180
     GAAAVGAAMW IGVLPGGFGA QWLAMSAGML AIGATVAGLV QLLGTKGIAP AALLFMLVGM       240
     PLAGIAAPPE FLPHVWGVLG QSLPIGATGT ALRGAAFFAP DALIGAGAGA AFAVLGAWIV       300
     VGYGLLTIGV ARHRAQPSGA PSGERTPDAA VATPA                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page