(data stored in ACNUC1104 zone)

EMBL: CP001966.PE450

CP001966.PE450       Location/Qualifiers
FT   CDS             488975..489556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0463"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bcv:Bcav_3630
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77104"
FT                   /db_xref="GOA:D5US37"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:D5US37"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77104.1"
FT                   /translation="MGTGRRAGASTAKADILEAARELFAEVGYDRATIRAIAARAGVDV
FT                   ALVSYYYGNKKGLFRGVMSMPVDPEAIFTAALDGPRDGVGERLLRAALTIWEGPETSEA
FT                   FRALLRAAADADEGAARTFGEFLSSVMIPTLTTHAGVGIETARVVASNLFGLAFLRYLI
FT                   AAPLFVAPSTEELIATYGAAVQRIIDADAG"
     MGTGRRAGAS TAKADILEAA RELFAEVGYD RATIRAIAAR AGVDVALVSY YYGNKKGLFR        60
     GVMSMPVDPE AIFTAALDGP RDGVGERLLR AALTIWEGPE TSEAFRALLR AAADADEGAA       120
     RTFGEFLSSV MIPTLTTHAG VGIETARVVA SNLFGLAFLR YLIAAPLFVA PSTEELIATY       180
     GAAVQRIIDA DAG                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page