(data stored in ACNUC1104 zone)

EMBL: CP001966.PE451

CP001966.PE451       Location/Qualifiers
FT   CDS             complement(489647..490231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmi:MMAR_2661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77105"
FT                   /db_xref="UniProtKB/TrEMBL:D5US38"
FT                   /inference="similar to AA sequence:KEGG:MMAR_2661"
FT                   /protein_id="ADG77105.1"
FT                   /translation="MPEYVSYEEFGRRFFEIAVNEERVGSAFADIAGGDFTVGPIPSGP
FT                   GGVAKVWAKVQIDEPQLTRHVGELITFTVKIPLRIGLLIDLKVDRIRYDVAGLITLPLT
FT                   VRAAAPLELRIEVDAPKPKDVWVDVESHSIRGSIVRVVASVDSEIRRFIAQYVAEEIDK
FT                   PEVKKARIIDVSEELGRAFHNLGDEDAADSA"
     MPEYVSYEEF GRRFFEIAVN EERVGSAFAD IAGGDFTVGP IPSGPGGVAK VWAKVQIDEP        60
     QLTRHVGELI TFTVKIPLRI GLLIDLKVDR IRYDVAGLIT LPLTVRAAAP LELRIEVDAP       120
     KPKDVWVDVE SHSIRGSIVR VVASVDSEIR RFIAQYVAEE IDKPEVKKAR IIDVSEELGR       180
     AFHNLGDEDA ADSA                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page