(data stored in ACNUC1104 zone)

EMBL: CP001966.PE453

CP001966.PE453       Location/Qualifiers
FT   CDS             493808..494359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0466"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   rer:RER_53690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77107"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D5US40"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ADG77107.1"
FT                   /translation="MAYVTRLRGAVAGLAGSGPLYSPDDAPPAPVAIAFGASVRGGRPG
FT                   SFVEGRLEAALRLYRIGKVQRILVSGNANGLSGDEIEVMTRWLRERGVPDEALLTDGAA
FT                   LDTYLSCVHARDRFGIDRVLLVSQFFHARRAVVLARHLGLDADAVRAEAGCSRRAWVRN
FT                   LAREYLLSRPKAALDIARNR"
     MAYVTRLRGA VAGLAGSGPL YSPDDAPPAP VAIAFGASVR GGRPGSFVEG RLEAALRLYR        60
     IGKVQRILVS GNANGLSGDE IEVMTRWLRE RGVPDEALLT DGAALDTYLS CVHARDRFGI       120
     DRVLLVSQFF HARRAVVLAR HLGLDADAVR AEAGCSRRAW VRNLAREYLL SRPKAALDIA       180
     RNR                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page