(data stored in ACNUC1104 zone)

EMBL: CP001966.PE454

CP001966.PE454       Location/Qualifiers
FT   CDS             494382..494711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77108"
FT                   /db_xref="GOA:D5US41"
FT                   /db_xref="UniProtKB/TrEMBL:D5US41"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77108.1"
FT                   /translation="MNRRVLGEVGRAIAVLAVIVAGGVVGFGSWALMFVQADARGMGVD
FT                   PGAGLALGFLGLIWSGVCLVAAGVAGDLLVYGESRRARLVGIGVMALILACTGLLLWCV
FT                   AKLSL"
     MNRRVLGEVG RAIAVLAVIV AGGVVGFGSW ALMFVQADAR GMGVDPGAGL ALGFLGLIWS        60
     GVCLVAAGVA GDLLVYGESR RARLVGIGVM ALILACTGLL LWCVAKLSL                   109
//

If you have problems or comments...

PBIL Back to PBIL home page