(data stored in ACNUC1104 zone)

EMBL: CP001966.PE456

CP001966.PE456       Location/Qualifiers
FT   CDS             496069..496563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_3729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77110"
FT                   /db_xref="InterPro:IPR032330"
FT                   /db_xref="UniProtKB/TrEMBL:D5US43"
FT                   /inference="similar to AA sequence:KEGG:Bcav_3729"
FT                   /protein_id="ADG77110.1"
FT                   /translation="MHALTQQQILDSFRGATKSEVKRVTFPQDVDEIRFDRLEFLGWHD
FT                   RKIARRAYVCVPMEEGPVTLLFTQAEAKPKAKAMCTWCRDVNITSQAVLFSVRRGGPAG
FT                   RKGDTMAVLVCEDFSCAANARKLPPAFHKATDLDAIREQNLAELRRRVTGFVAEVLSTE
FT                   E"
     MHALTQQQIL DSFRGATKSE VKRVTFPQDV DEIRFDRLEF LGWHDRKIAR RAYVCVPMEE        60
     GPVTLLFTQA EAKPKAKAMC TWCRDVNITS QAVLFSVRRG GPAGRKGDTM AVLVCEDFSC       120
     AANARKLPPA FHKATDLDAI REQNLAELRR RVTGFVAEVL STEE                        164
//

If you have problems or comments...

PBIL Back to PBIL home page