(data stored in ACNUC1104 zone)

EMBL: CP001966.PE459

CP001966.PE459       Location/Qualifiers
FT   CDS             498620..499429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0472"
FT                   /product="Squalene/phytoene synthase"
FT                   /note="PFAM: Squalene/phytoene synthase; KEGG:
FT                   krh:KRH_20840 phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77113"
FT                   /db_xref="GOA:D5US46"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="UniProtKB/TrEMBL:D5US46"
FT                   /inference="protein motif:PFAM:PF00494"
FT                   /protein_id="ADG77113.1"
FT                   /translation="MDSTERYTAAAVAASAVVIRQYSTSFSLASRMMPRRVRSHITSIY
FT                   GLVRVADEVVDGACPVDPRAHLDALEVATERAIETGFSTDLVVHAFANTARATGFGTEL
FT                   TRPFFASMRADLTPAPHTAESLAQYIYGSAEVVGLMCLRAYLHGAAPSDYEALASDAKR
FT                   LGAAFQKINFLRDLTDDELRLGRAYLPELTPDAYAAALADAREDLEQARRGIARLPGDV
FT                   RRGVRAAADLYSALLHRLEAAGLDGARAGRVRVPAASKLLAVVRGVR"
     MDSTERYTAA AVAASAVVIR QYSTSFSLAS RMMPRRVRSH ITSIYGLVRV ADEVVDGACP        60
     VDPRAHLDAL EVATERAIET GFSTDLVVHA FANTARATGF GTELTRPFFA SMRADLTPAP       120
     HTAESLAQYI YGSAEVVGLM CLRAYLHGAA PSDYEALASD AKRLGAAFQK INFLRDLTDD       180
     ELRLGRAYLP ELTPDAYAAA LADAREDLEQ ARRGIARLPG DVRRGVRAAA DLYSALLHRL       240
     EAAGLDGARA GRVRVPAASK LLAVVRGVR                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page