(data stored in ACNUC1104 zone)

EMBL: CP001966.PE461

CP001966.PE461       Location/Qualifiers
FT   CDS             500513..500854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0474"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: kra:Krad_2816 transcriptional regulator, PadR- like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77115"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5US48"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADG77115.1"
FT                   /translation="MSVAAWQRATLPLLILGVLESAPRHGYGISAALVDVGLHPIKGAQ
FT                   LYPALVKLENEGAIVATWEQSESGPARKVYELTATGRTQLATLREDWRTFTTAAAQLGA
FT                   AATTPSTRR"
     MSVAAWQRAT LPLLILGVLE SAPRHGYGIS AALVDVGLHP IKGAQLYPAL VKLENEGAIV        60
     ATWEQSESGP ARKVYELTAT GRTQLATLRE DWRTFTTAAA QLGAAATTPS TRR              113
//

If you have problems or comments...

PBIL Back to PBIL home page