(data stored in ACNUC1104 zone)

EMBL: CP001966.PE462

CP001966.PE462       Location/Qualifiers
FT   CDS             complement(500923..501795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0475"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: cmi:CMM_2872
FT                   putative hydrolase/acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77116"
FT                   /db_xref="GOA:D5US49"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5US49"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG77116.1"
FT                   /translation="MISTIAVNGRWARVRAEGDESKPTVLLLHGITRSLEDWDPQFESL
FT                   SGDFRLIATDLPGYGWSAPHPDGAGLPALARGVGETLDALKVTGPVHVVGNSLGGAVTM
FT                   TLLTQRPEQVATITLVDSAGFGKEVTPLLRLLGLPLIGKLMATTPSRLSAIIQERLIFA
FT                   DKSFATRARIDHAMKIARETDAGLTTWRTADSLGSVLGGVQQEWRDELQATIAKTPRPT
FT                   MVLWGDRDKILPPKHLSAARALIPHAEGHLIPGVGHMPQLECAPEFDALLTDFLERNAT
FT                   PELHPAASQ"
     MISTIAVNGR WARVRAEGDE SKPTVLLLHG ITRSLEDWDP QFESLSGDFR LIATDLPGYG        60
     WSAPHPDGAG LPALARGVGE TLDALKVTGP VHVVGNSLGG AVTMTLLTQR PEQVATITLV       120
     DSAGFGKEVT PLLRLLGLPL IGKLMATTPS RLSAIIQERL IFADKSFATR ARIDHAMKIA       180
     RETDAGLTTW RTADSLGSVL GGVQQEWRDE LQATIAKTPR PTMVLWGDRD KILPPKHLSA       240
     ARALIPHAEG HLIPGVGHMP QLECAPEFDA LLTDFLERNA TPELHPAASQ                  290
//

If you have problems or comments...

PBIL Back to PBIL home page