(data stored in ACNUC1104 zone)

EMBL: CP001966.PE467

CP001966.PE467       Location/Qualifiers
FT   CDS             505254..505730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0480"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: bcv:Bcav_2882 activator of HSP90 ATPase 1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77121"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D5US54"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ADG77121.1"
FT                   /translation="MPVLSTTSDREALTFDLVAEFATSPERVWQLWEDPRLLEKWWGPP
FT                   TWPATFVRHELTPGGQSRYYMTGPDGTKAGGWWETVATDAPSTFVFRDGFAGEDGEPVD
FT                   PEDYSTNTVVLTRTGDVTRMNLTAAHRSLEQLDRVLEMGMTEAMNQIDALLAAV"
     MPVLSTTSDR EALTFDLVAE FATSPERVWQ LWEDPRLLEK WWGPPTWPAT FVRHELTPGG        60
     QSRYYMTGPD GTKAGGWWET VATDAPSTFV FRDGFAGEDG EPVDPEDYST NTVVLTRTGD       120
     VTRMNLTAAH RSLEQLDRVL EMGMTEAMNQ IDALLAAV                               158
//

If you have problems or comments...

PBIL Back to PBIL home page