(data stored in ACNUC1104 zone)

EMBL: CP001966.PE472

CP001966.PE472       Location/Qualifiers
FT   CDS             512096..514141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0485"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: cgt:cgR_0148 hypothetical protein; TIGRFAM:
FT                   heavy metal translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC;
FT                   cadmium-translocating P-type ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77126"
FT                   /db_xref="GOA:D5US59"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5US59"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADG77126.1"
FT                   /translation="MSAEHDHDSGHSARWEIGFAIASGVTYVSGMIAEYALDQPSVATF
FT                   FFLATYFFGGYFTIRSAIQSTLNGKFEVDFLMLVAAIGAASIGRFAEGAVLLFLFSLGH
FT                   ALEEYALARASKSIEALAELAPRTALVHTGGPSNLSGEFAEKSVDDLEVGDLVLIRPNA
FT                   RVSADGFVVDGRSAIDQSAVTGESMPVEKEPVGSPAAAAARPTNVPAEHRVFAGTVNGS
FT                   GALVVQATALAKDSTLSKVVELVASTDQAKSPTQRFLDKFQRIYVPAVIAFVIGVFLVG
FT                   YFALGNPFTDAFYLAMAVLVAASPCALALATPSAVLAGVARAARAGVLIKGGAPLETLG
FT                   RVSSIAFDKTGTLTWGEPQVTDTVAAPGVDLDDLLATTLAVEKLSDHPLAAAVTDGIAN
FT                   RTSTVLTATDLQSVTGRGVRATIDGDAVEIGNARLFTDADIALDEVAADIDRLQAAGRT
FT                   LMIVRRGGRFLGVIGVMDTPRREAGEVLDRLRESGMTDIVMISGDHQQVADAVGKEVGV
FT                   DRALGGLLPEDKVTQIRDMSGSKEEPAGTSGRRCAMVGDGVNDAPAMAQADVGIAMGAA
FT                   GSAVALETADVALMSDDLGRLPFAVRLSRQTSRIIRQNLIASLGIVVFLIIVTFLGMPM
FT                   GPVVFIHEGSTLIVVANALRLLRFDVGKEHDGVEHEARPEKVPAAA"
     MSAEHDHDSG HSARWEIGFA IASGVTYVSG MIAEYALDQP SVATFFFLAT YFFGGYFTIR        60
     SAIQSTLNGK FEVDFLMLVA AIGAASIGRF AEGAVLLFLF SLGHALEEYA LARASKSIEA       120
     LAELAPRTAL VHTGGPSNLS GEFAEKSVDD LEVGDLVLIR PNARVSADGF VVDGRSAIDQ       180
     SAVTGESMPV EKEPVGSPAA AAARPTNVPA EHRVFAGTVN GSGALVVQAT ALAKDSTLSK       240
     VVELVASTDQ AKSPTQRFLD KFQRIYVPAV IAFVIGVFLV GYFALGNPFT DAFYLAMAVL       300
     VAASPCALAL ATPSAVLAGV ARAARAGVLI KGGAPLETLG RVSSIAFDKT GTLTWGEPQV       360
     TDTVAAPGVD LDDLLATTLA VEKLSDHPLA AAVTDGIANR TSTVLTATDL QSVTGRGVRA       420
     TIDGDAVEIG NARLFTDADI ALDEVAADID RLQAAGRTLM IVRRGGRFLG VIGVMDTPRR       480
     EAGEVLDRLR ESGMTDIVMI SGDHQQVADA VGKEVGVDRA LGGLLPEDKV TQIRDMSGSK       540
     EEPAGTSGRR CAMVGDGVND APAMAQADVG IAMGAAGSAV ALETADVALM SDDLGRLPFA       600
     VRLSRQTSRI IRQNLIASLG IVVFLIIVTF LGMPMGPVVF IHEGSTLIVV ANALRLLRFD       660
     VGKEHDGVEH EARPEKVPAA A                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page