(data stored in ACNUC1104 zone)

EMBL: CP001966.PE474

CP001966.PE474       Location/Qualifiers
FT   CDS             516564..517163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0487"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: rha:RHA1_ro05498 heat
FT                   shock protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77128"
FT                   /db_xref="GOA:D5US61"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D5US61"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADG77128.1"
FT                   /translation="MTTPENPVDPEEVNTEAEGVEAGTVTAAAEDSAAAAADEAGSTDA
FT                   PSDEVAELTADLQRVTAEYANYRKRTARDVVDARAAGKAAVVAELLVVLDDLDRARSHG
FT                   DLEAGPLKSVSDKLDGVLSGLGLAPFGAEGDEFDPSIHEAVQHEGDGADPVLGAVLRQG
FT                   YQIDGKVIRNAMVAVVDRPEPDASGQGATDADQDES"
     MTTPENPVDP EEVNTEAEGV EAGTVTAAAE DSAAAAADEA GSTDAPSDEV AELTADLQRV        60
     TAEYANYRKR TARDVVDARA AGKAAVVAEL LVVLDDLDRA RSHGDLEAGP LKSVSDKLDG       120
     VLSGLGLAPF GAEGDEFDPS IHEAVQHEGD GADPVLGAVL RQGYQIDGKV IRNAMVAVVD       180
     RPEPDASGQG ATDADQDES                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page