(data stored in ACNUC1104 zone)

EMBL: CP001966.PE475

CP001966.PE475       Location/Qualifiers
FT   CDS             517180..518382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0488"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: chaperone
FT                   DnaJ domain protein; heat shock protein DnaJ domain
FT                   protein; DnaJ central domain protein; KEGG: rop:ROP_55740
FT                   chaperone protein DnaJ; SMART: heat shock protein DnaJ
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77129"
FT                   /db_xref="GOA:D5US62"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D5US62"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ADG77129.1"
FT                   /translation="MTQREWVEQDFYRELGVSSDASQDDIKKAYRKLAAELHPDRNPGD
FT                   AKAEERFKRVSEANSVLSDPAKRKEYDETRRLFGGGRFGSNGGGFGTGGFGNTGGGTGG
FT                   FSFSDIFDGATGGGGGGFGDIFEGLFNRGGGAPGGASGSGPQPSRPRRGNDLESEITLG
FT                   FRDATLGVTTPITLTSPSPCTTCHGSGAKPGTSPRVCQSCNGSGLVSRNQGAFSFSEPC
FT                   PDCRGTGSVIDDPCTDCSGTGVTVRTRTVNVKIPPGVKDGQRIRLAGQGQAGMRGAPSG
FT                   DLFVVVHVKADDVFTRSGDDLLVTLPVSFSELALGSTVTVPTLGQPVGVKIPAGTTDGR
FT                   TLRVRGRGVPKRSGGHGDLLVKVQVSVPGSLDEAAQAALRTYAEAEKASGFDPRSGWAG
FT                   A"
     MTQREWVEQD FYRELGVSSD ASQDDIKKAY RKLAAELHPD RNPGDAKAEE RFKRVSEANS        60
     VLSDPAKRKE YDETRRLFGG GRFGSNGGGF GTGGFGNTGG GTGGFSFSDI FDGATGGGGG       120
     GFGDIFEGLF NRGGGAPGGA SGSGPQPSRP RRGNDLESEI TLGFRDATLG VTTPITLTSP       180
     SPCTTCHGSG AKPGTSPRVC QSCNGSGLVS RNQGAFSFSE PCPDCRGTGS VIDDPCTDCS       240
     GTGVTVRTRT VNVKIPPGVK DGQRIRLAGQ GQAGMRGAPS GDLFVVVHVK ADDVFTRSGD       300
     DLLVTLPVSF SELALGSTVT VPTLGQPVGV KIPAGTTDGR TLRVRGRGVP KRSGGHGDLL       360
     VKVQVSVPGS LDEAAQAALR TYAEAEKASG FDPRSGWAGA                             400
//

If you have problems or comments...

PBIL Back to PBIL home page