(data stored in ACNUC1104 zone)

EMBL: CP001966.PE477

CP001966.PE477       Location/Qualifiers
FT   CDS             518802..519062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_1837c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77131"
FT                   /db_xref="UniProtKB/TrEMBL:D5US64"
FT                   /inference="similar to AA sequence:KEGG:MAB_1837c"
FT                   /protein_id="ADG77131.1"
FT                   /translation="MSERIVFRRTDGGRTTVRHHPTDDGAGFRLAIIDGEVPDEATVDP
FT                   AALYFIDDYDPRSLVSDAGLVVSCGEPPHFGAWERLDAWPV"
     MSERIVFRRT DGGRTTVRHH PTDDGAGFRL AIIDGEVPDE ATVDPAALYF IDDYDPRSLV        60
     SDAGLVVSCG EPPHFGAWER LDAWPV                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page