(data stored in ACNUC1104 zone)

EMBL: CP001966.PE484

CP001966.PE484       Location/Qualifiers
FT   CDS             526499..527356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77138"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D5US71"
FT                   /inference="similar to AA sequence:KEGG:Mjls_0128"
FT                   /protein_id="ADG77138.1"
FT                   /translation="MRPTDVGIRSGDLVATATSHEIRTRYRQVYRGVRLPAGAVVGLVE
FT                   RIEAALLLYPHAVLCGWTAAALHGAGYTAGRPIEIWLPARRVRAGIVVRCGAMPDEDVV
FT                   VREAFPLTTGVRTAIDVVRYAEGDDAVAALDQCFRLDGYGRSVTSRDAVVDYLERHHNL
FT                   HRSTRVVRALRWADGRAESPPETFTRLLLHRAGLSMFVPQVPVDGGRFRLDLAAEEFQV
FT                   AVEYDGRDHSDPAQQSLDIARRNTLRHDYGWEVLPITASILRNGREAFLRQTRAALRDR
FT                   GWRG"
     MRPTDVGIRS GDLVATATSH EIRTRYRQVY RGVRLPAGAV VGLVERIEAA LLLYPHAVLC        60
     GWTAAALHGA GYTAGRPIEI WLPARRVRAG IVVRCGAMPD EDVVVREAFP LTTGVRTAID       120
     VVRYAEGDDA VAALDQCFRL DGYGRSVTSR DAVVDYLERH HNLHRSTRVV RALRWADGRA       180
     ESPPETFTRL LLHRAGLSMF VPQVPVDGGR FRLDLAAEEF QVAVEYDGRD HSDPAQQSLD       240
     IARRNTLRHD YGWEVLPITA SILRNGREAF LRQTRAALRD RGWRG                       285
//

If you have problems or comments...

PBIL Back to PBIL home page