(data stored in ACNUC1104 zone)

EMBL: CP001966.PE485

CP001966.PE485       Location/Qualifiers
FT   CDS             complement(527416..528567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0498"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; 3-
FT                   dehydroquinate synthase; KEGG: tfu:Tfu_2801 glycerol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77139"
FT                   /db_xref="GOA:D5US72"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D5US72"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADG77139.1"
FT                   /translation="MSDTVSTAIFASPSRYVQGRGALDALGEHVAKLGGTPLIVSDDTV
FT                   WGIVQDGVTASFDAAGLPVTRVPFKQFATPAAVDDLVATIGSGGHDVILGVGGGSAIDA
FT                   AKAAGHLAGIRWVSVPTAASSDAPTSTLAVIYTETGEFLEYRFFPRNPDLVLIDTQLVA
FT                   NAPVSLLVAGIGDALATWIEARATRRGRGSTMAGGRPTRAGTALAELSWDILWENAELA
FT                   IDAVRSKVVTPALEAVVEANTLLSGLGFESGGLAAAHAIHNGLTAAPQTHGLTHGQKVN
FT                   IGSITQLVLEGAPSVEIEDFVEFTTAVGLPNSLTEIGLTPDDTPELQAIAEAATAAAET
FT                   IHNLPSPVTPAQVVDALKAIETISRRVRIERGLPEPVKYVAKH"
     MSDTVSTAIF ASPSRYVQGR GALDALGEHV AKLGGTPLIV SDDTVWGIVQ DGVTASFDAA        60
     GLPVTRVPFK QFATPAAVDD LVATIGSGGH DVILGVGGGS AIDAAKAAGH LAGIRWVSVP       120
     TAASSDAPTS TLAVIYTETG EFLEYRFFPR NPDLVLIDTQ LVANAPVSLL VAGIGDALAT       180
     WIEARATRRG RGSTMAGGRP TRAGTALAEL SWDILWENAE LAIDAVRSKV VTPALEAVVE       240
     ANTLLSGLGF ESGGLAAAHA IHNGLTAAPQ THGLTHGQKV NIGSITQLVL EGAPSVEIED       300
     FVEFTTAVGL PNSLTEIGLT PDDTPELQAI AEAATAAAET IHNLPSPVTP AQVVDALKAI       360
     ETISRRVRIE RGLPEPVKYV AKH                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page