(data stored in ACNUC1104 zone)

EMBL: CP001966.PE487

CP001966.PE487       Location/Qualifiers
FT   CDS             complement(528902..529288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0500"
FT                   /product="protein of unknown function DUF202"
FT                   /note="PFAM: protein of unknown function DUF202; KEGG:
FT                   mlu:Mlut_04300 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77141"
FT                   /db_xref="GOA:D5US74"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:D5US74"
FT                   /inference="protein motif:PFAM:PF02656"
FT                   /protein_id="ADG77141.1"
FT                   /translation="MTPASVVAVRNLWPPRELTEGESPDARFTLANERTFLAWIRTALG
FT                   LVAAAVGLEAFAPDVVPAAVRTPLVVILLVVAAGLAGYAFRRWLSVEGAMRTGRPLRGS
FT                   PATVVLAAVIAVTGLILAATIAFT"
     MTPASVVAVR NLWPPRELTE GESPDARFTL ANERTFLAWI RTALGLVAAA VGLEAFAPDV        60
     VPAAVRTPLV VILLVVAAGL AGYAFRRWLS VEGAMRTGRP LRGSPATVVL AAVIAVTGLI       120
     LAATIAFT                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page