(data stored in ACNUC1104 zone)

EMBL: CP001966.PE49

CP001966.PE49        Location/Qualifiers
FT   CDS             51608..52165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0049"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   rop:ROP_55140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76703"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT5"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ADG76703.1"
FT                   /translation="MSKVKIAIWSTAVLVVVFLGAVAAVGYPVFGQAKQDPLERVDAVV
FT                   VLGGEHDGREQYGLQLAKEGYAPTLVLSNPYEPDDHVMAPLCDRRVDGIEVLCEVPDPS
FT                   TTRGEALFTERLARERGWKKVIVVSWRYHLPRSRYIFGNCFAGETVMRAVPREYAFGPA
FT                   DWELIYLYQSFAMAKAMVQGGC"
     MSKVKIAIWS TAVLVVVFLG AVAAVGYPVF GQAKQDPLER VDAVVVLGGE HDGREQYGLQ        60
     LAKEGYAPTL VLSNPYEPDD HVMAPLCDRR VDGIEVLCEV PDPSTTRGEA LFTERLARER       120
     GWKKVIVVSW RYHLPRSRYI FGNCFAGETV MRAVPREYAF GPADWELIYL YQSFAMAKAM       180
     VQGGC                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page