(data stored in ACNUC1104 zone)

EMBL: CP001966.PE493

CP001966.PE493       Location/Qualifiers
FT   CDS             533263..535311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cai:Caci_6901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77147"
FT                   /db_xref="UniProtKB/TrEMBL:D5US80"
FT                   /inference="similar to AA sequence:KEGG:Caci_6901"
FT                   /protein_id="ADG77147.1"
FT                   /translation="MTVPVESPDLVWPLAGGRVRIDGETGSPVDFVHDQYPEVKYLLDD
FT                   SVDTWHSSEHRWGSGFVITPERGFRWNVPDRLVMREDSSVATFDLGGGLDLVVERRAGA
FT                   GLSERYTFRNRTDDELMLGSIGITVPFRDVYEDAEISLDRGVHAHVWPGGANSWVIAEP
FT                   MSGSRAALSLSTTEGELRAYSIDSRNQFTSSNVRGHIVVHPTDAARNPSAFGGQEQVVI
FT                   SPGGEWTIAWTVRWHESREAAFDAVAPSWSLDRYAAPIGEPITVRGSDSVRASAGVVVA
FT                   RGAEGATVTSEASGVQYIEIGRSQAAVLFHRPVRDIVTRRIGFIIERQRAVERGGIDAH
FT                   AFVPYDCRAGLTRSTCGWPDWSDGAERLAMPTLIQQARRRGWVGAEVDDVLHDWADFAR
FT                   ERLLDPSGAPLWGSVTHHSETRLYNAPWLVQFFADQFQIYARREDLDSAVRILERSIEL
FT                   GAESHLSIGHPEATLFVCELLDAADEHEDAEGFRQHLVASARHFAELGTRLPNHEVRYE
FT                   QSMVAPLVTLYAAALRIAPDQVAIRRRLPEAVRWMMAFGGRQPHVRLHEISIRHWDGYW
FT                   FGKNRQWGDVFPHHWSVLTAIALMQLASADRPRNSVDTATAIFAANLASFFDDGSATAA
FT                   FVLPSTVDGVPAYRADPLANDQDWALTLLLRTGLVDEKGVGLRAPAE"
     MTVPVESPDL VWPLAGGRVR IDGETGSPVD FVHDQYPEVK YLLDDSVDTW HSSEHRWGSG        60
     FVITPERGFR WNVPDRLVMR EDSSVATFDL GGGLDLVVER RAGAGLSERY TFRNRTDDEL       120
     MLGSIGITVP FRDVYEDAEI SLDRGVHAHV WPGGANSWVI AEPMSGSRAA LSLSTTEGEL       180
     RAYSIDSRNQ FTSSNVRGHI VVHPTDAARN PSAFGGQEQV VISPGGEWTI AWTVRWHESR       240
     EAAFDAVAPS WSLDRYAAPI GEPITVRGSD SVRASAGVVV ARGAEGATVT SEASGVQYIE       300
     IGRSQAAVLF HRPVRDIVTR RIGFIIERQR AVERGGIDAH AFVPYDCRAG LTRSTCGWPD       360
     WSDGAERLAM PTLIQQARRR GWVGAEVDDV LHDWADFARE RLLDPSGAPL WGSVTHHSET       420
     RLYNAPWLVQ FFADQFQIYA RREDLDSAVR ILERSIELGA ESHLSIGHPE ATLFVCELLD       480
     AADEHEDAEG FRQHLVASAR HFAELGTRLP NHEVRYEQSM VAPLVTLYAA ALRIAPDQVA       540
     IRRRLPEAVR WMMAFGGRQP HVRLHEISIR HWDGYWFGKN RQWGDVFPHH WSVLTAIALM       600
     QLASADRPRN SVDTATAIFA ANLASFFDDG SATAAFVLPS TVDGVPAYRA DPLANDQDWA       660
     LTLLLRTGLV DEKGVGLRAP AE                                                682
//

If you have problems or comments...

PBIL Back to PBIL home page