(data stored in ACNUC1104 zone)

EMBL: CP001966.PE495

CP001966.PE495       Location/Qualifiers
FT   CDS             complement(536988..537623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0508"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   rha:RHA1_ro05534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77149"
FT                   /db_xref="GOA:D5US82"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D5US82"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADG77149.1"
FT                   /translation="MLEFVQNAGPVMIWLVVAGFVFAECAFIIGLFLPGDSLLLTAGLA
FT                   MATTGHSAASVWGLALAAFLAAIAGNHVGYGIGEKMGDHVLAKQDGRYLNAHNLHRVKE
FT                   LMDKHGFFSVLIARWIPWVRTLCPLVAGAVGMDKRKFTIASVLGSLIWAPFLLLVGYYA
FT                   SSALQDYKWVLDWALRGMIVMLVVGTVVGIIGYRREMAKPNVSVDLED"
     MLEFVQNAGP VMIWLVVAGF VFAECAFIIG LFLPGDSLLL TAGLAMATTG HSAASVWGLA        60
     LAAFLAAIAG NHVGYGIGEK MGDHVLAKQD GRYLNAHNLH RVKELMDKHG FFSVLIARWI       120
     PWVRTLCPLV AGAVGMDKRK FTIASVLGSL IWAPFLLLVG YYASSALQDY KWVLDWALRG       180
     MIVMLVVGTV VGIIGYRREM AKPNVSVDLE D                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page