(data stored in ACNUC1104 zone)

EMBL: CP001966.PE496

CP001966.PE496       Location/Qualifiers
FT   CDS             complement(537632..538351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0509"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   rer:RER_14110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77150"
FT                   /db_xref="GOA:D5US83"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D5US83"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADG77150.1"
FT                   /translation="MYFTDLTLATSTTLQAFSISDITDPVAVLNAFGPIALVGLLLVVF
FT                   IESGVLFPVLPGDSLLFVAGLLTAAGTGAAVGEATYTGSAMSLPVLLIGVPIAAILGSQ
FT                   VGYFIGRFGGEKLFKPDARFLKTKYLDESHEFFEKYGPATLVLARFVPFVRTFAPVAAG
FT                   AAHMNYVKFVIWNAIGAIIWGDGILLLGVWLGQIDWVRDNIDKIFIGIVLVSVLPIVWG
FT                   VAKKYLSDRRANSSASA"
     MYFTDLTLAT STTLQAFSIS DITDPVAVLN AFGPIALVGL LLVVFIESGV LFPVLPGDSL        60
     LFVAGLLTAA GTGAAVGEAT YTGSAMSLPV LLIGVPIAAI LGSQVGYFIG RFGGEKLFKP       120
     DARFLKTKYL DESHEFFEKY GPATLVLARF VPFVRTFAPV AAGAAHMNYV KFVIWNAIGA       180
     IIWGDGILLL GVWLGQIDWV RDNIDKIFIG IVLVSVLPIV WGVAKKYLSD RRANSSASA        239
//

If you have problems or comments...

PBIL Back to PBIL home page