(data stored in ACNUC1104 zone)

EMBL: CP001966.PE498

CP001966.PE498       Location/Qualifiers
FT   CDS             540292..541320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0511"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="KEGG: rha:RHA1_ro05536 fructose-bisphosphate
FT                   aldolase; TIGRFAM: fructose-bisphosphate aldolase, class
FT                   II; ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77152"
FT                   /db_xref="GOA:D5US85"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5US85"
FT                   /inference="protein motif:TFAM:TIGR01520"
FT                   /protein_id="ADG77152.1"
FT                   /translation="MPIATPEAYREMLDRARKGGYAFPAINCTSSETINAAIKGFADAG
FT                   SDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFAHVVAAKYDVTVALHTDHCPKDKLDG
FT                   LVRPLLEISQERVNNGQNPLFQSHMWDGSAVPLEENLEIAQELLAKCKAANIILEIEIG
FT                   VVGGEEDGVENEINDKLFTSNEDFAKTVDALGTDGYLLAATFGNVHGVYKPGNVKLRPS
FT                   VLRDGQAVAAQKQGLPEGSKPFSFVFHGGSGSLKSEIEESLSYGVVKMNVDTDTQYAFT
FT                   RPVAGHMFSNYDGVLKIDGEVGNKKTYDPRSYLKKAETSMAERVVEACNDLHSAGKSIS
FT                   AK"
     MPIATPEAYR EMLDRARKGG YAFPAINCTS SETINAAIKG FADAGSDGII QFSTGGAEFG        60
     SGLGVKDMVT GAVALAEFAH VVAAKYDVTV ALHTDHCPKD KLDGLVRPLL EISQERVNNG       120
     QNPLFQSHMW DGSAVPLEEN LEIAQELLAK CKAANIILEI EIGVVGGEED GVENEINDKL       180
     FTSNEDFAKT VDALGTDGYL LAATFGNVHG VYKPGNVKLR PSVLRDGQAV AAQKQGLPEG       240
     SKPFSFVFHG GSGSLKSEIE ESLSYGVVKM NVDTDTQYAF TRPVAGHMFS NYDGVLKIDG       300
     EVGNKKTYDP RSYLKKAETS MAERVVEACN DLHSAGKSIS AK                          342
//

If you have problems or comments...

PBIL Back to PBIL home page