(data stored in ACNUC1104 zone)

EMBL: CP001966.PE5

CP001966.PE5         Location/Qualifiers
FT   CDS             5069..6274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0005"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: rer:RER_00040 DNA
FT                   replication and repair protein RecF; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76659"
FT                   /db_xref="GOA:D5UPA7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPA7"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADG76659.1"
FT                   /translation="MYVRRLRLHDFRSWDDVDIELGPGVTVFVGRNGFGKTNLIEALNY
FT                   LATLGSHRVSTDQPLIRVGTESATVLATVHNAGRELTAEVDIVAGRANKARINTAPSRR
FT                   PRDLLGILQSVLFAPEDLSLVRGDPGGRRRFLDELAILRTPRIAAEKADYDRVLKQRTA
FT                   LLKTAYAAARRGGPDAESMLATLDVWDVQLARFGAEMLAARLEVVAALQPHLTVAYGAL
FT                   APHSRAATMEYTSGLFDDEFGGDPATATVAELEEAMLAGLQRARSREIDRGVCLVGPHR
FT                   DDLDLRLGNEPAKGFASHGESWSYALALRLASLELLRAGGSDPVLLLDDVFAELDTKRR
FT                   TALADVAAETEQVIVTAAVPEDLPPTLRARTFEVTVEGPADARISRLRSAPDDDRPDET
FT                   AS"
     MYVRRLRLHD FRSWDDVDIE LGPGVTVFVG RNGFGKTNLI EALNYLATLG SHRVSTDQPL        60
     IRVGTESATV LATVHNAGRE LTAEVDIVAG RANKARINTA PSRRPRDLLG ILQSVLFAPE       120
     DLSLVRGDPG GRRRFLDELA ILRTPRIAAE KADYDRVLKQ RTALLKTAYA AARRGGPDAE       180
     SMLATLDVWD VQLARFGAEM LAARLEVVAA LQPHLTVAYG ALAPHSRAAT MEYTSGLFDD       240
     EFGGDPATAT VAELEEAMLA GLQRARSREI DRGVCLVGPH RDDLDLRLGN EPAKGFASHG       300
     ESWSYALALR LASLELLRAG GSDPVLLLDD VFAELDTKRR TALADVAAET EQVIVTAAVP       360
     EDLPPTLRAR TFEVTVEGPA DARISRLRSA PDDDRPDETA S                           401
//

If you have problems or comments...

PBIL Back to PBIL home page