(data stored in ACNUC1104 zone)

EMBL: CP001966.PE50

CP001966.PE50        Location/Qualifiers
FT   CDS             complement(52162..52539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0050"
FT                   /product="camphor resistance CrcB protein"
FT                   /note="KEGG: rha:RHA1_ro06412 camphor resistance CrcB
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76704"
FT                   /db_xref="GOA:D5UPT6"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT6"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro06412"
FT                   /protein_id="ADG76704.1"
FT                   /translation="MINPLLAALGGAFGAAIGYRTARLAPENRATALLLVTAAASLVLG
FT                   AIARAGAIAHGSPAGAFLIGLCGTAVSFAALAWCLVRAERPVRAVLAVAIIVGMSVAAA
FT                   MLGYLASDLLGLASVKLPKVG"
     MINPLLAALG GAFGAAIGYR TARLAPENRA TALLLVTAAA SLVLGAIARA GAIAHGSPAG        60
     AFLIGLCGTA VSFAALAWCL VRAERPVRAV LAVAIIVGMS VAAAMLGYLA SDLLGLASVK       120
     LPKVG                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page