(data stored in ACNUC1104 zone)

EMBL: CP001966.PE503

CP001966.PE503       Location/Qualifiers
FT   CDS             complement(545237..545872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa53740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77157"
FT                   /db_xref="UniProtKB/TrEMBL:D5US90"
FT                   /inference="similar to AA sequence:KEGG:nfa53740"
FT                   /protein_id="ADG77157.1"
FT                   /translation="MSSVTQSTVVLRAPDVRIPAGLRDLETVTVDLDSVKAELKRKMPY
FT                   PRRLIVAGPDELLAAVIARLLAAERLDVEVAFAPTENSRASAIYPPGDPLTGVPRSVPL
FT                   IRDDRGFVLVGQARITGPDGGPLTGETFVDSEKLFTGQAKAIIVEPTGSGAGVRARLAK
FT                   GMRRKWLSGRAAQTGGLELVVTRDGRTDPSVVTRSTFYRHTDDWLLIS"
     MSSVTQSTVV LRAPDVRIPA GLRDLETVTV DLDSVKAELK RKMPYPRRLI VAGPDELLAA        60
     VIARLLAAER LDVEVAFAPT ENSRASAIYP PGDPLTGVPR SVPLIRDDRG FVLVGQARIT       120
     GPDGGPLTGE TFVDSEKLFT GQAKAIIVEP TGSGAGVRAR LAKGMRRKWL SGRAAQTGGL       180
     ELVVTRDGRT DPSVVTRSTF YRHTDDWLLI S                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page