(data stored in ACNUC1104 zone)

EMBL: CP001966.PE504

CP001966.PE504       Location/Qualifiers
FT   CDS             545957..547243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0517"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="SMART: adenylosuccinate synthetase; TIGRFAM:
FT                   adenylosuccinate synthetase; KEGG: rha:RHA1_ro05551
FT                   adenylosuccinate synthetase; PFAM: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77158"
FT                   /db_xref="GOA:D5US91"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D5US91"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADG77158.1"
FT                   /translation="MPAIVLIGAQWGDEGKGKATDLLGEKLQWVVRYQGGNNAGHTVVL
FT                   PNGDKFALHLIPSGILTPGVKNVIGNGVVVDPSVLLQELDGLEARGVDTSNLLLSADAH
FT                   LLMPYHVAIDKVTERFLGNKKIGTTGRGIGPCYQDKIARVGVRAQDVLDESILTQKVEA
FT                   ALEFKNQVLTKIYNRRALDPRQVVDETLELAESFKHRIADTRLELNKALERGETVLLEG
FT                   SQGTLLDVDHGTYPFVTSSNPTSGGASVGSGIGPTRITTVLGILKAYTTRVGSGPFPTE
FT                   LFDEWGEYLAKHGGEVGVTTGRARRCGWFDAVIARYATRVNGITDYFLTKLDVLSSIEN
FT                   VPICVAYEIDGVRYDEMPTTQSQVHHATPIFETMPGWWEDISECRTFEELPKNAQNYVL
FT                   RLEELSGAHISCIGVGPGRDETIVRRPIV"
     MPAIVLIGAQ WGDEGKGKAT DLLGEKLQWV VRYQGGNNAG HTVVLPNGDK FALHLIPSGI        60
     LTPGVKNVIG NGVVVDPSVL LQELDGLEAR GVDTSNLLLS ADAHLLMPYH VAIDKVTERF       120
     LGNKKIGTTG RGIGPCYQDK IARVGVRAQD VLDESILTQK VEAALEFKNQ VLTKIYNRRA       180
     LDPRQVVDET LELAESFKHR IADTRLELNK ALERGETVLL EGSQGTLLDV DHGTYPFVTS       240
     SNPTSGGASV GSGIGPTRIT TVLGILKAYT TRVGSGPFPT ELFDEWGEYL AKHGGEVGVT       300
     TGRARRCGWF DAVIARYATR VNGITDYFLT KLDVLSSIEN VPICVAYEID GVRYDEMPTT       360
     QSQVHHATPI FETMPGWWED ISECRTFEEL PKNAQNYVLR LEELSGAHIS CIGVGPGRDE       420
     TIVRRPIV                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page