(data stored in ACNUC1104 zone)

EMBL: CP001966.PE505

CP001966.PE505       Location/Qualifiers
FT   CDS             547457..549109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6766 PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77159"
FT                   /db_xref="UniProtKB/TrEMBL:D5US92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77159.1"
FT                   /translation="MKLKSIRSGALTSVLAVATVVGVVGAQLAVPPTAERSSPGVEYVL
FT                   TAGDPSDGSASSGSDSSGSGSAAGESNDAPTAAGSASGTETGSPTATDTAAEKSGTAGT
FT                   ATGAQTTGTASAGTANGAAATGTQTTGTATGSAPEQPTATTTPTGTTEAAPTTAVAPAT
FT                   TQAGTAAPSAAVVPSATAPSATASSEPSPSGASTSATATPKTATGQSDAQQPTVAPSAS
FT                   PRTDTASPGGDTTVPAAPSSPFVQLARDIGGALGGLIGTGTGGLVGVVGGADFATPART
FT                   LGSSIGSAIAAVAAGAAEGAASELLGWNHGLDLIGGGLGIAGATVKGAATELGRSLPGL
FT                   GGAVLTSAEQVVVPLSKTVAGATGTAVGGAIGTSLAAVASAAATATGVGVVLVPFLAAG
FT                   LPYAGARIGGSIGGVVGDVVGDALTGGFRGAAAGGGIGGIIGGAYDSATTGTPLLAALR
FT                   ASAEAGLQGAASAGPAGAVVGAATGFPSLGAAIGELIGKVGASPFDVPGLPRIVGPTAE
FT                   LLGRTIGGGIGGAANLAIGTIGGLIGVTLGKDK"
     MKLKSIRSGA LTSVLAVATV VGVVGAQLAV PPTAERSSPG VEYVLTAGDP SDGSASSGSD        60
     SSGSGSAAGE SNDAPTAAGS ASGTETGSPT ATDTAAEKSG TAGTATGAQT TGTASAGTAN       120
     GAAATGTQTT GTATGSAPEQ PTATTTPTGT TEAAPTTAVA PATTQAGTAA PSAAVVPSAT       180
     APSATASSEP SPSGASTSAT ATPKTATGQS DAQQPTVAPS ASPRTDTASP GGDTTVPAAP       240
     SSPFVQLARD IGGALGGLIG TGTGGLVGVV GGADFATPAR TLGSSIGSAI AAVAAGAAEG       300
     AASELLGWNH GLDLIGGGLG IAGATVKGAA TELGRSLPGL GGAVLTSAEQ VVVPLSKTVA       360
     GATGTAVGGA IGTSLAAVAS AAATATGVGV VLVPFLAAGL PYAGARIGGS IGGVVGDVVG       420
     DALTGGFRGA AAGGGIGGII GGAYDSATTG TPLLAALRAS AEAGLQGAAS AGPAGAVVGA       480
     ATGFPSLGAA IGELIGKVGA SPFDVPGLPR IVGPTAELLG RTIGGGIGGA ANLAIGTIGG       540
     LIGVTLGKDK                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page