(data stored in ACNUC1104 zone)

EMBL: CP001966.PE507

CP001966.PE507       Location/Qualifiers
FT   CDS             549786..550460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0520"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: cai:Caci_5788 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77161"
FT                   /db_xref="GOA:D5US94"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5US94"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG77161.1"
FT                   /translation="MRVLVVEDELFLAEAVRDGLRLEAIAADIAGDGDTALEMLSVNSY
FT                   DIAVLDRDIPGPSGDEIAANIVASGTGMPILMLTAADRLDDKESGFELGADDYLTKPFE
FT                   LRELVLRLRALDRRRAHSRPPVREIAGLRLDPFRREVFRNGKYVALTRKQFAVLEVLVA
FT                   AEGGVVSAEELLERAWDENADPFTNAVRITVSALRKRLGEPGIVATVPGVGYRIDAGAC
FT                   DD"
     MRVLVVEDEL FLAEAVRDGL RLEAIAADIA GDGDTALEML SVNSYDIAVL DRDIPGPSGD        60
     EIAANIVASG TGMPILMLTA ADRLDDKESG FELGADDYLT KPFELRELVL RLRALDRRRA       120
     HSRPPVREIA GLRLDPFRRE VFRNGKYVAL TRKQFAVLEV LVAAEGGVVS AEELLERAWD       180
     ENADPFTNAV RITVSALRKR LGEPGIVATV PGVGYRIDAG ACDD                        224
//

If you have problems or comments...

PBIL Back to PBIL home page