(data stored in ACNUC1104 zone)

EMBL: CP001966.PE508

CP001966.PE508       Location/Qualifiers
FT   CDS             550453..551580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0521"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: fre:Franean1_7134 integral membrane sensor
FT                   signal transduction histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase HAMP region domain protein; histidine kinase A
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77162"
FT                   /db_xref="GOA:D5US95"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5US95"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG77162.1"
FT                   /translation="MTRPPGLSARLKLTLSYAGFLMVAGGLLLAVVWVFLLRYVPEVIA
FT                   VPDLGPREPGSGAGPQLMGIPNRADLQAAFAPKATLVLGLLLIFGLVGGWLLAGRMLAP
FT                   LNRITHATRLAAEGSLAHRIHLEGRADEFRELADAFDAMLARLEAHVAEQQRFAANASH
FT                   ELRTPLAITQTLLDVARSDPERDDDELVSRLQFVNARAIDLTEALLLLSRADRRSFTRE
FT                   SVDLSLIAEEAVETLLPLAEGRGVVLEAVGGLTPTTGSPALIQQVATNLVHNAIVHNLP
FT                   GGGTVRVRTETVADGAQLTVENTGAPLSPQVVATLTEPFQRGTGRISGGHAGVGLGLAI
FT                   VDRIVRAHDGALTLTPRPDGGLRVTVRLPAATGSP"
     MTRPPGLSAR LKLTLSYAGF LMVAGGLLLA VVWVFLLRYV PEVIAVPDLG PREPGSGAGP        60
     QLMGIPNRAD LQAAFAPKAT LVLGLLLIFG LVGGWLLAGR MLAPLNRITH ATRLAAEGSL       120
     AHRIHLEGRA DEFRELADAF DAMLARLEAH VAEQQRFAAN ASHELRTPLA ITQTLLDVAR       180
     SDPERDDDEL VSRLQFVNAR AIDLTEALLL LSRADRRSFT RESVDLSLIA EEAVETLLPL       240
     AEGRGVVLEA VGGLTPTTGS PALIQQVATN LVHNAIVHNL PGGGTVRVRT ETVADGAQLT       300
     VENTGAPLSP QVVATLTEPF QRGTGRISGG HAGVGLGLAI VDRIVRAHDG ALTLTPRPDG       360
     GLRVTVRLPA ATGSP                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page