(data stored in ACNUC1104 zone)

EMBL: CP001966.PE509

CP001966.PE509       Location/Qualifiers
FT   CDS             complement(551638..552270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0522"
FT                   /product="D-Ala-D-Ala dipeptidase"
FT                   /EC_number="3.4.13.22"
FT                   /note="KEGG: cai:Caci_5792 peptidase M15D VanX D-ala-D-ala
FT                   dipeptidase; PFAM: peptidase M15D vanX D-ala-D-ala
FT                   dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77163"
FT                   /db_xref="GOA:D5US96"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D5US96"
FT                   /inference="protein motif:PRIAM:3.4.13.22"
FT                   /protein_id="ADG77163.1"
FT                   /translation="MNTDFVYVDEHVPGVRWDAKYATWDNFTGKPVDGYLANRIVGTRV
FT                   LCAGLRLAQRHAATLGYGLLLWDGYRPQRAVDRFVAWSRQPENGRTKQRHYPNIARADM
FT                   FELGYVATRSGHSRGSTVDLTLYHLDSGDLADMGGDHDLMDPVSHHGAPGIGEPAARNR
FT                   ARLATIMEDAGFLRYDSEWWHYTLHDEPFPTTYFDFPITLAAGSRAA"
     MNTDFVYVDE HVPGVRWDAK YATWDNFTGK PVDGYLANRI VGTRVLCAGL RLAQRHAATL        60
     GYGLLLWDGY RPQRAVDRFV AWSRQPENGR TKQRHYPNIA RADMFELGYV ATRSGHSRGS       120
     TVDLTLYHLD SGDLADMGGD HDLMDPVSHH GAPGIGEPAA RNRARLATIM EDAGFLRYDS       180
     EWWHYTLHDE PFPTTYFDFP ITLAAGSRAA                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page