(data stored in ACNUC1104 zone)

EMBL: CP001966.PE516

CP001966.PE516       Location/Qualifiers
FT   CDS             complement(559527..560249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0529"
FT                   /product="FAD-binding 9 siderophore-interacting domain
FT                   protein"
FT                   /note="PFAM: FAD-binding 9 siderophore-interacting domain
FT                   protein; Siderophore-interacting protein; KEGG: nfa:nfa7590
FT                   putative siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77170"
FT                   /db_xref="GOA:D5USA3"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA3"
FT                   /inference="protein motif:PFAM:PF08021"
FT                   /protein_id="ADG77170.1"
FT                   /translation="MGRGVTGLILKAMRADDYVFTVLSTEAVGEHYHRIRFDGGTFLTQ
FT                   NPWFPTMWVRLWVPKNGEATTDEDDGTLAQRGYTIIDPEGSEFTIEFAIHDGPAPRWAR
FT                   DAEPGDRIAATMMGADLAVPDNPAPSEYILVGDAASIPAINSLLTTATAPCRVFLEYQH
FT                   AAERDLPVRSENVTWVPREGRGATLVSAVTKAAIPHDAFLFVAAETKATREITKAAKKD
FT                   FGLTKDRIKSQAYWLQRG"
     MGRGVTGLIL KAMRADDYVF TVLSTEAVGE HYHRIRFDGG TFLTQNPWFP TMWVRLWVPK        60
     NGEATTDEDD GTLAQRGYTI IDPEGSEFTI EFAIHDGPAP RWARDAEPGD RIAATMMGAD       120
     LAVPDNPAPS EYILVGDAAS IPAINSLLTT ATAPCRVFLE YQHAAERDLP VRSENVTWVP       180
     REGRGATLVS AVTKAAIPHD AFLFVAAETK ATREITKAAK KDFGLTKDRI KSQAYWLQRG       240
//

If you have problems or comments...

PBIL Back to PBIL home page