(data stored in ACNUC1104 zone)

EMBL: CP001966.PE518

CP001966.PE518       Location/Qualifiers
FT   CDS             561341..562009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0531"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; KEGG:
FT                   cgt:cgR_0900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77172"
FT                   /db_xref="GOA:D5USA5"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA5"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ADG77172.1"
FT                   /translation="MLASTCTVAFVAERPDGRRVALTAGHCGKRGQAVGAPVPGKPDAL
FT                   VRVGTFAQSSNPPARTTPEGYVLPEDLTAPDWGVIDLRPTTKSAAERGPVRPTRVGEAR
FT                   VGDRVCQQGVTSGWRCGVVRVVSPTQISTDITSRPGDSGGPLIRLSDGAALGIVSGGTA
FT                   AEAPRDVPRMTFYWSLRDALAQGGGLRLVTAGTPAAQRVSSPEVREVITVDGTVPVGVF
FT                   "
     MLASTCTVAF VAERPDGRRV ALTAGHCGKR GQAVGAPVPG KPDALVRVGT FAQSSNPPAR        60
     TTPEGYVLPE DLTAPDWGVI DLRPTTKSAA ERGPVRPTRV GEARVGDRVC QQGVTSGWRC       120
     GVVRVVSPTQ ISTDITSRPG DSGGPLIRLS DGAALGIVSG GTAAEAPRDV PRMTFYWSLR       180
     DALAQGGGLR LVTAGTPAAQ RVSSPEVREV ITVDGTVPVG VF                          222
//

If you have problems or comments...

PBIL Back to PBIL home page