(data stored in ACNUC1104 zone)

EMBL: CP001966.PE52

CP001966.PE52        Location/Qualifiers
FT   CDS             complement(52982..54580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0052"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="TIGRFAM: exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase; KEGG: rer:RER_13170
FT                   glycosyltransferase; PFAM: sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76706"
FT                   /db_xref="GOA:D5UPT8"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT8"
FT                   /inference="protein motif:TFAM:TIGR03025"
FT                   /protein_id="ADG76706.1"
FT                   /translation="MTELSSETSGPHAHRGVTTHPTLPPHPPRTSPTAPASDVPAAPPV
FT                   SPDTASLADTGAAPEPPATTGSRSVPRGAVLTDDIVVATVAAASGSVAAIAAGVPAATA
FT                   VAVIIAIHAVWVGALSSSRTLAVPLLRLGSAEFRHVLRATAVVFGITGIVEAYLHVPLL
FT                   QAVIRASLPVALGGVLLCRMLWGRRVRTQTDQEFRTPTLVVGSFFATRATAAALLREGR
FT                   SGAEVVGACLPEGESELYESIPLDDGTAIPVVGSDQTLLAAIDRTGARAVALTPTDTLG
FT                   PGDLRKLIWELDEKQVELVLVPGVVDVAGHRVVYQSVSGMPMLSIARPQHRRADSMAKR
FT                   TFDIVFATIALLFTFPVTLAVAIAVKIDSRGPLFYSAERVGAGGKTFHMVKFRSMVDGA
FT                   DSYRDALADKDIGAGVLFKIPDDPRVTRIGRIVRRYSIDELPQFINVLKGEMSVVGPRP
FT                   ALPAEVAQYPPVMRRRHLVKPGITGAWQVSGRSDLSWDESVRLDVGYVENWSLFTDLSI
FT                   VARTVGTVVGSSGAY"
     MTELSSETSG PHAHRGVTTH PTLPPHPPRT SPTAPASDVP AAPPVSPDTA SLADTGAAPE        60
     PPATTGSRSV PRGAVLTDDI VVATVAAASG SVAAIAAGVP AATAVAVIIA IHAVWVGALS       120
     SSRTLAVPLL RLGSAEFRHV LRATAVVFGI TGIVEAYLHV PLLQAVIRAS LPVALGGVLL       180
     CRMLWGRRVR TQTDQEFRTP TLVVGSFFAT RATAAALLRE GRSGAEVVGA CLPEGESELY       240
     ESIPLDDGTA IPVVGSDQTL LAAIDRTGAR AVALTPTDTL GPGDLRKLIW ELDEKQVELV       300
     LVPGVVDVAG HRVVYQSVSG MPMLSIARPQ HRRADSMAKR TFDIVFATIA LLFTFPVTLA       360
     VAIAVKIDSR GPLFYSAERV GAGGKTFHMV KFRSMVDGAD SYRDALADKD IGAGVLFKIP       420
     DDPRVTRIGR IVRRYSIDEL PQFINVLKGE MSVVGPRPAL PAEVAQYPPV MRRRHLVKPG       480
     ITGAWQVSGR SDLSWDESVR LDVGYVENWS LFTDLSIVAR TVGTVVGSSG AY               532
//

If you have problems or comments...

PBIL Back to PBIL home page