(data stored in ACNUC1104 zone)

EMBL: CP001966.PE520

CP001966.PE520       Location/Qualifiers
FT   CDS             complement(562619..564007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0533"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: rha:RHA1_ro02240 ferredoxin--NADP(+)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77174"
FT                   /db_xref="GOA:D5USA7"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA7"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADG77174.1"
FT                   /translation="MTEQNRPLRVAIVGAGPAGIYAADALMKSDEAKDPGVSIDLFEKM
FT                   PAPFGLIRYGVAPDHPRIKGIITALHKVLDKPQVRLLGNLDFGKDFSLAEVRKHYDAVI
FT                   FSTGAVADRNLDIPGIDLDGSYGAAEFVAWYDGHPDFSREWPLEAEKVAVLGVGNVGLD
FT                   VARVLAKTADELLPTEIPPNVYEGLKQNKATEVHVFGRRGPAQVKFTPLELKELDHSQT
FT                   IEVVVSPEDIEYDEGSAKARRESKITDQVAVILENYAIREPNNRPHKLFIHLFESPVEI
FT                   LGEDGKVVGLRTERTELDGTGNVKGTGKFTDWELGAVYRAVGYLSNDLPEIPFDDQAGV
FT                   IPNEAGRVIDAGEHIPGVYTTGWIKRGPVGLIGHTKGDANETIACLLEDFHAGKLNQPA
FT                   DPSLEGVTNWLDDHETPYTTWDGWYRLDEHERSLGEAEGRERVKVVERDDMLAASEPSK
FT                   VQPS"
     MTEQNRPLRV AIVGAGPAGI YAADALMKSD EAKDPGVSID LFEKMPAPFG LIRYGVAPDH        60
     PRIKGIITAL HKVLDKPQVR LLGNLDFGKD FSLAEVRKHY DAVIFSTGAV ADRNLDIPGI       120
     DLDGSYGAAE FVAWYDGHPD FSREWPLEAE KVAVLGVGNV GLDVARVLAK TADELLPTEI       180
     PPNVYEGLKQ NKATEVHVFG RRGPAQVKFT PLELKELDHS QTIEVVVSPE DIEYDEGSAK       240
     ARRESKITDQ VAVILENYAI REPNNRPHKL FIHLFESPVE ILGEDGKVVG LRTERTELDG       300
     TGNVKGTGKF TDWELGAVYR AVGYLSNDLP EIPFDDQAGV IPNEAGRVID AGEHIPGVYT       360
     TGWIKRGPVG LIGHTKGDAN ETIACLLEDF HAGKLNQPAD PSLEGVTNWL DDHETPYTTW       420
     DGWYRLDEHE RSLGEAEGRE RVKVVERDDM LAASEPSKVQ PS                          462
//

If you have problems or comments...

PBIL Back to PBIL home page