(data stored in ACNUC1104 zone)

EMBL: CP001966.PE522

CP001966.PE522       Location/Qualifiers
FT   CDS             564605..565033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0535"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: rop:ROP_19530
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77176"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA9"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ADG77176.1"
FT                   /translation="MEEVLVTYAGDITPAQAWQLLHDDPNAVLVDCRTEAEWNYVGIPD
FT                   LTVLRRAVVLVEWQTYPDGALNATFVDELRRKGVTDDAPVAFLCRSGHRSIGAAEAATA
FT                   AGIQRAFNVLDGFEGGLDAEGHRGAVGWRAEGLPWRQF"
     MEEVLVTYAG DITPAQAWQL LHDDPNAVLV DCRTEAEWNY VGIPDLTVLR RAVVLVEWQT        60
     YPDGALNATF VDELRRKGVT DDAPVAFLCR SGHRSIGAAE AATAAGIQRA FNVLDGFEGG       120
     LDAEGHRGAV GWRAEGLPWR QF                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page