(data stored in ACNUC1104 zone)

EMBL: CP001966.PE523

CP001966.PE523       Location/Qualifiers
FT   CDS             565043..566245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0536"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="4.4.1.1"
FT                   /note="TIGRFAM: O-succinylhomoserine sulfhydrylase; KEGG:
FT                   mab:MAB_4242c O-succinylhomoserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate- dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77177"
FT                   /db_xref="GOA:D5USB0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5USB0"
FT                   /inference="protein motif:TFAM:TIGR01325"
FT                   /protein_id="ADG77177.1"
FT                   /translation="MTEFNALPDGVHPETIGVRGGLLRSNHEETSEALYLNSGYTYDSA
FT                   EAAEAAFNGDIDRFVYSRYGNPTVAMFQERLRLLEGAEACFATASGMSAVFTALGALLQ
FT                   AGDRLVAARSLFGSCYVVCNEILPRWGIETVFVDGEDLAQWEEALSVPAQAVFFETPAN
FT                   PMQGLVDVRAVADLAHAAGAQVVLDAGFTPVGYQDCFGLGADVIVHSSTKSMDGQGRVM
FT                   GGAILGAFDYIDGPVKQLMRHTGPAMAPFNAWVLVKALETLDLRAERISANAQKVAEFL
FT                   DADPRVSKVLYPFLPSHPQHELATRQMKAGGTVITLELADSDVRGKDRAFQFLNRLQVI
FT                   DISNNFGDAKSLITHPATTTHRATGPEGRAKIGLTDSMLRLSVGLENVDDLIADLDRAL
FT                   G"
     MTEFNALPDG VHPETIGVRG GLLRSNHEET SEALYLNSGY TYDSAEAAEA AFNGDIDRFV        60
     YSRYGNPTVA MFQERLRLLE GAEACFATAS GMSAVFTALG ALLQAGDRLV AARSLFGSCY       120
     VVCNEILPRW GIETVFVDGE DLAQWEEALS VPAQAVFFET PANPMQGLVD VRAVADLAHA       180
     AGAQVVLDAG FTPVGYQDCF GLGADVIVHS STKSMDGQGR VMGGAILGAF DYIDGPVKQL       240
     MRHTGPAMAP FNAWVLVKAL ETLDLRAERI SANAQKVAEF LDADPRVSKV LYPFLPSHPQ       300
     HELATRQMKA GGTVITLELA DSDVRGKDRA FQFLNRLQVI DISNNFGDAK SLITHPATTT       360
     HRATGPEGRA KIGLTDSMLR LSVGLENVDD LIADLDRALG                             400
//

If you have problems or comments...

PBIL Back to PBIL home page