(data stored in ACNUC1104 zone)

EMBL: CP001966.PE528

CP001966.PE528       Location/Qualifiers
FT   CDS             complement(569593..570171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0541"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rer:pREL1_0102
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77182"
FT                   /db_xref="GOA:D5USB5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D5USB5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77182.1"
FT                   /translation="MPRTVDHGERRSELTDAVARIAARDGLQAVTMRAVAAEAGVSLRL
FT                   VQYYFENKHGLLIGAMRRLEEQSNARWRARLSNTADPRAMLHAFISEALPTDPESTDFY
FT                   RVSAAFGELARTDTELAAEPLAGGLTRLRSTVLDTFRAADLPPDADPEAETDALISLCN
FT                   GLSTAVLLGHHTADRAVAIASYHLDRVFR"
     MPRTVDHGER RSELTDAVAR IAARDGLQAV TMRAVAAEAG VSLRLVQYYF ENKHGLLIGA        60
     MRRLEEQSNA RWRARLSNTA DPRAMLHAFI SEALPTDPES TDFYRVSAAF GELARTDTEL       120
     AAEPLAGGLT RLRSTVLDTF RAADLPPDAD PEAETDALIS LCNGLSTAVL LGHHTADRAV       180
     AIASYHLDRV FR                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page