(data stored in ACNUC1104 zone)

EMBL: CP001966.PE529

CP001966.PE529       Location/Qualifiers
FT   CDS             571798..572964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0543"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   art:Arth_3119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77183"
FT                   /db_xref="GOA:D5USB6"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:D5USB6"
FT                   /inference="protein motif:PFAM:PF01139"
FT                   /protein_id="ADG77183.1"
FT                   /translation="MEKISKSLVSWASILDEKTREQAITTAKLPFIYPHIALMPDAHLG
FT                   KGATVGSVIPSLGAVIPAAVGVDIGCGMIAVRTQFTKSDLPDDRATVREAIERAVPLSP
FT                   GRYNTKVVATAEPRIAELIALAERAEFDPAQYAGNWALQLGTLGGGNHFIEISLDEDDT
FT                   VWAFLHSGSRGVGNKIAQQHIAVATRLCRQWWIDLPDPDLAYLVEGTPEFRRYIAELKW
FT                   AQHFALLNREEMMDRVIRQLGEWVGTPVSEAERINCHHNFTKREKHFGKEVWVSRKGAI
FT                   EAAEGKLGLIPGSMGTASYIVEGRGFPPSLNSSPHGAGREYSRSAARRTFTHEQLREAM
FT                   AGIEFRDSADFVDEIPQAYKPIDRVMTDAAELVTVRAVLRQIVNVKGQ"
     MEKISKSLVS WASILDEKTR EQAITTAKLP FIYPHIALMP DAHLGKGATV GSVIPSLGAV        60
     IPAAVGVDIG CGMIAVRTQF TKSDLPDDRA TVREAIERAV PLSPGRYNTK VVATAEPRIA       120
     ELIALAERAE FDPAQYAGNW ALQLGTLGGG NHFIEISLDE DDTVWAFLHS GSRGVGNKIA       180
     QQHIAVATRL CRQWWIDLPD PDLAYLVEGT PEFRRYIAEL KWAQHFALLN REEMMDRVIR       240
     QLGEWVGTPV SEAERINCHH NFTKREKHFG KEVWVSRKGA IEAAEGKLGL IPGSMGTASY       300
     IVEGRGFPPS LNSSPHGAGR EYSRSAARRT FTHEQLREAM AGIEFRDSAD FVDEIPQAYK       360
     PIDRVMTDAA ELVTVRAVLR QIVNVKGQ                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page