(data stored in ACNUC1104 zone)

EMBL: CP001966.PE533

CP001966.PE533       Location/Qualifiers
FT   CDS             575974..576363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0547"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rer:RER_05550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77187"
FT                   /db_xref="GOA:D5USC0"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77187.1"
FT                   /translation="MTATASRPALVIVVDGEPAATELTRVRAADLRLAQKQRDYLRAEA
FT                   ARAGREPDAVALEVDVVIDEHAAQARASYAGLGATADGVTYVGTPSGLKSLIEDVYAAE
FT                   VADAVVLRPVGGDRTQQLIASLLAA"
     MTATASRPAL VIVVDGEPAA TELTRVRAAD LRLAQKQRDY LRAEAARAGR EPDAVALEVD        60
     VVIDEHAAQA RASYAGLGAT ADGVTYVGTP SGLKSLIEDV YAAEVADAVV LRPVGGDRTQ       120
     QLIASLLAA                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page